PDB entry 1bhq

View 1bhq on RCSB PDB site
Description: mac-1 i domain cadmium complex
Deposited on 1998-06-10, released 1998-11-04
The last revision prior to the SCOP 1.55 freeze date was dated 1998-11-18, with a file datestamp of 1998-11-18.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.175
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Domains in SCOP 1.55: d1bhq1_
  • Chain '2':
    Domains in SCOP 1.55: d1bhq2_

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bhq1 (1:)
    sdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqnn
    pnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplgy
    edvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnql
    rekifaieg
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bhq2 (2:)
    sdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqnn
    pnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplgy
    edvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnql
    rekifaieg