PDB entry 1bhq

View 1bhq on RCSB PDB site
Description: mac-1 I domain cadmium complex
Class: cell adhesion
Keywords: cell adhesion, integrin, I domain
Deposited on 1998-06-10, released 1998-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.175
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: cd11b
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bhq1_
  • Chain '2':
    Compound: cd11b
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bhq2_
  • Heterogens: CD, ACE, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bhq1 (1:)
    sdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqnn
    pnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplgy
    edvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnql
    rekifaieg
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bhq2 (2:)
    sdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqnn
    pnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplgy
    edvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnql
    rekifaieg