PDB entry 1bhp

View 1bhp on RCSB PDB site
Description: structure of beta-purothionin at room temperature and 1.7 angstroms resolution
Class: plant toxin
Keywords: plant toxin, thionins
Deposited on 1995-03-15, released 1996-03-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.198
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-purothionin
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bhpa_
  • Heterogens: PO4, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bhpA (A:)
    kscckstlgrncynlcrargaqklcanvcrckltsglscpkdfpk