PDB entry 1bhn

View 1bhn on RCSB PDB site
Description: nucleoside diphosphate kinase isoform a from bovine retina
Class: phosphotransferase
Keywords: phosphotransferase
Deposited on 1998-06-10, released 1999-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.2
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleoside diphosphate transferase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bhna_
  • Chain 'B':
    Compound: nucleoside diphosphate transferase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bhnb_
  • Chain 'C':
    Compound: nucleoside diphosphate transferase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bhnc_
  • Chain 'D':
    Compound: nucleoside diphosphate transferase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bhnd_
  • Chain 'E':
    Compound: nucleoside diphosphate transferase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bhne_
  • Chain 'F':
    Compound: nucleoside diphosphate transferase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bhnf_
  • Heterogens: 35G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bhnA (A:)
    mansertfiaikpdgvqrgligeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
    dsvesaekeialwfhpeelvnykscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bhnA (A:)
    ansertfiaikpdgvqrgligeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpff
    aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svesaekeialwfhpeelvnykscaqnwiye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bhnB (B:)
    mansertfiaikpdgvqrgligeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
    dsvesaekeialwfhpeelvnykscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bhnB (B:)
    ansertfiaikpdgvqrgligeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpff
    aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svesaekeialwfhpeelvnykscaqnwiye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bhnC (C:)
    mansertfiaikpdgvqrgligeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
    dsvesaekeialwfhpeelvnykscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bhnC (C:)
    ansertfiaikpdgvqrgligeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpff
    aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svesaekeialwfhpeelvnykscaqnwiye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bhnD (D:)
    mansertfiaikpdgvqrgligeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
    dsvesaekeialwfhpeelvnykscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bhnD (D:)
    ansertfiaikpdgvqrgligeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpff
    aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svesaekeialwfhpeelvnykscaqnwiye
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1bhnE (E:)
    mansertfiaikpdgvqrgligeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
    dsvesaekeialwfhpeelvnykscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bhnE (E:)
    ansertfiaikpdgvqrgligeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpff
    aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svesaekeialwfhpeelvnykscaqnwiye
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1bhnF (F:)
    mansertfiaikpdgvqrgligeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
    dsvesaekeialwfhpeelvnykscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bhnF (F:)
    ansertfiaikpdgvqrgligeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpff
    aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svesaekeialwfhpeelvnykscaqnwiye