PDB entry 1bhm

View 1bhm on RCSB PDB site
Description: restriction endonuclease bamhi complex with DNA
Class: hydrolase/DNA
Keywords: hydrolase, complex (endonuclease/DNA), nuclease, hydrolase/DNA complex
Deposited on 1995-07-12, released 1995-07-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.189
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (bamhi (e.c.3.1.21.4))
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bhma_
  • Chain 'B':
    Compound: protein (bamhi (e.c.3.1.21.4))
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bhmb_
  • Chain 'C':
    Compound: DNA (5'-d(*tp*ap*tp*gp*gp*ap*tp*cp*cp*ap*tp*a)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*tp*ap*tp*gp*gp*ap*tp*cp*cp*ap*tp*a)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bhmA (A:)
    mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
    kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa
    hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn
    aeaynsnvplipkgsdgmskrsikkwkdkvenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bhmA (A:)
    mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
    kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa
    hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn
    aeaynsnvplipkgsdgm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bhmB (B:)
    mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
    kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa
    hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn
    aeaynsnvplipkgsdgmskrsikkwkdkvenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bhmB (B:)
    mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
    kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa
    hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn
    aeaynsnvplipkgsdgmskrsikkwkd
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.