PDB entry 1bhi

View 1bhi on RCSB PDB site
Description: structure of transactivation domain of cre-bp1/atf-2, nmr, 20 structures
Class: DNA-binding regulatory protein
Keywords: cre binding protein, atf-2, transcriptional activation domain, zn finger, DNA-binding regulatory protein
Deposited on 1998-06-09, released 1999-06-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cre-bp1
    Species: Homo sapiens [TaxId:9606]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1bhia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bhiA (A:)
    msddkpflctapgcgqrftnedhlavhkhkhemtlkfg