PDB entry 1bhh

View 1bhh on RCSB PDB site
Description: free p56lck sh2 domain
Class: sh2 domain
Keywords: sh2 domain, phosphorylation, transferase
Deposited on 1998-06-08, released 1998-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.24
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t-lymphocyte-specific protein tyrosine kinase p56lck
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bhha_
  • Chain 'B':
    Compound: p56 lck tyrosine kinase sh2 domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bhhb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1bhhA (A:)
anslepepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevv
khykirnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt

    Sequence, based on observed residues (ATOM records): (download) 
    >1bhhA (A:)
epepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhyk
irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bhhB (B:)
pepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhyki
rnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt