PDB entry 1bhe

View 1bhe on RCSB PDB site
Description: polygalacturonase from erwinia carotovora ssp. carotovora
Class: glycosidase
Keywords: family 28 glycosyl hydrolase, hydrolyses polygalacturonic acid, glycosidase
Deposited on 1998-06-05, released 1998-11-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polygalacturonase
    Species: Pectobacterium carotovorum subsp. carotovorum [TaxId:555]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1bhea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bheA (A:)
    sdsrtvsepktpsscttlkadsstatstiqkalnncdqgkavrlsagstsvflsgplslp
    sgvsllidkgvtlravnnaksfenapsscgvvdkngkgcdafitavsttnsgiygpgtid
    gqggvklqdkkvswwelaadakvkklkqntprliqinksknftlynvslinspnfhvvfs
    dgdgftawkttiktpstarntdgidpmssknitiaysniatgddnvaikaykgraetrni
    silhndfgtghgmsigsetmgvynvtvddlkmngttnglriksdksaagvvngvrysnvv
    mknvakpividtvyekkegsnvpdwsditfkdvtsetkgvvvlngenakkpievtmknvk
    ltsdstwqiknvnvkk