PDB entry 1bhd

View 1bhd on RCSB PDB site
Description: second calponin homology domain from utrophin
Class: structural protein
Keywords: calponin homology, actin binding, structural protein
Deposited on 1998-06-05, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: utrophin
    Species: Homo sapiens [TaxId:9606]
    Gene: UTRN, DMDL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bhda_
  • Chain 'B':
    Compound: utrophin
    Species: Homo sapiens [TaxId:9606]
    Gene: UTRN, DMDL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bhdb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bhdA (A:)
    msdlqqtnsekillswvrqttrpysqvnvlnfttswtdglafnavlhrhkpdlfswdkvv
    kmspierlehafskaqtylgieklldpedvavrlpdkksiimyltslfevlpqqvtid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bhdA (A:)
    lqqtnsekillswvrqttrpysqvnvlnfttswtdglafnavlhrhkpdlfswdkvvkms
    pierlehafskaqtylgieklldpedvavrlpdkksiimyltslfevl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bhdB (B:)
    msdlqqtnsekillswvrqttrpysqvnvlnfttswtdglafnavlhrhkpdlfswdkvv
    kmspierlehafskaqtylgieklldpedvavrlpdkksiimyltslfevlpqqvtid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bhdB (B:)
    nsekillswvrqttrpysqvnvlnfttswtdglafnavlhrhkpdlfswdkvvkmspier
    lehafskaqtylgieklldpedvavrlpdkksiimyltslfevlpqqv