PDB entry 1bha

View 1bha on RCSB PDB site
Description: three-dimensional structure of (1-71) bacterioopsin solubilized in methanol-chloroform and sds micelles determined by 15n-1h heteronuclear nmr spectroscopy
Class: photoreceptor
Keywords: photoreceptor
Deposited on 1993-10-11, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: bacteriorhodopsin
  Species: Halobacterium salinarum [TaxId:2242]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02945
  Domains in SCOPe 2.08: d1bhaa_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1bhaA (A:)
  qaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsm
  llgygltmvpf
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1bhaA (A:)
  aqitgrpewiwlalgtalmglgtlyflvkgmgvpdakkfyaittlvpaiaftmylsmllg
  ygltmvp