PDB entry 1bh9

View 1bh9 on RCSB PDB site
Description: htafii18/htafii28 heterodimer crystal structure with bound pcmbs
Deposited on 1998-06-16, released 1999-06-22
The last revision prior to the SCOP 1.69 freeze date was dated 1999-06-22, with a file datestamp of 1999-06-21.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.205
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1bh9a_
  • Chain 'B':
    Domains in SCOP 1.69: d1bh9b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bh9A (A:)
lfskelrcmmygfgddqnpytesvdiledlviefitemthkamsi

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bh9B (B:)
fseeqlnryemyrrsafpkaaikrliqsitgtsvsqnvviamsgiskvfvgevveealdv
cekwgempplqpkhmreavrrlkskgqip