PDB entry 1bh7

View 1bh7 on RCSB PDB site
Description: a low energy structure for the final cytoplasmic loop of band 3, nmr, minimized average structure
Class: membrane protein
Keywords: membrane protein, cytoplasmic loop, anion exchange protein
Deposited on 1998-06-16, released 1998-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: band 3
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02730 (0-32)
  Domains in SCOPe 2.08: d1bh7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1bh7A (A:)
  iqlfdrilllfkppkyhpdvpyvkrvktwrmhl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1bh7A (A:)
  iqlfdrillfkppkyhpdpyvkrvktwrmhl