PDB entry 1bh6

View 1bh6 on RCSB PDB site
Description: subtilisin dy in complex with the synthetic inhibitor n-benzyloxycarbonyl-ala-pro-phe-chloromethyl ketone
Class: hydrolase
Keywords: hydrolase, subtilisin, protein degradation
Deposited on 1998-06-15, released 1998-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.14
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: subtilisin dy
    Species: Bacillus licheniformis [TaxId:1402]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00781 (0-273)
      • conflict (36)
      • conflict (101)
      • conflict (156)
      • conflict (192)
    Domains in SCOPe 2.07: d1bh6a_
  • Heterogens: CA, NA, 1BH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bh6A (A:)
    aqtvpygiplikadkvqaqgykganvkvgiidtgiasshtdlkvvggasfvsgesyntdg
    nghgthvagtvaaldnttgvlgvapnvslyaikvlnssgsgsysaivsgiewatqngldv
    inmslggpsgstalkqavdkayasgivvvaaagnsgnsgsqntigypakydsviavgavd
    snknrasfssvgselevmapgvsvystypsntytslngtsmasphvagaaalilskyptl
    sasqvrnrlsstatnlgdsfyygkglinveaaaq