PDB entry 1bh5

View 1bh5 on RCSB PDB site
Description: human glyoxalase I q33e, e172q double mutant
Class: lyase
Keywords: lyase, lactoylglutathione lyase, glyoxalase I
Deposited on 1998-06-13, released 1998-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.19
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactoylglutathione lyase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04760 (Start-182)
      • mutation (32)
      • variant (109)
      • mutation (171)
    Domains in SCOPe 2.07: d1bh5a_
  • Chain 'B':
    Compound: lactoylglutathione lyase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04760 (Start-182)
      • mutation (32)
      • variant (109)
      • mutation (171)
    Domains in SCOPe 2.07: d1bh5b_
  • Chain 'C':
    Compound: lactoylglutathione lyase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04760 (Start-182)
      • mutation (32)
      • variant (109)
      • mutation (171)
    Domains in SCOPe 2.07: d1bh5c_
  • Chain 'D':
    Compound: lactoylglutathione lyase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04760 (Start-182)
      • mutation (32)
      • variant (109)
      • mutation (171)
    Domains in SCOPe 2.07: d1bh5d_
  • Heterogens: ZN, GTX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bh5A (A:)
    aepqppsggltdeaalsccsdadpstkdfllqetmlrvkdpkksldfytrvlgmtliqkc
    dfpimkfslyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhngnsd
    prgfghigiavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywiqilnpnkma
    tlm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bh5A (A:)
    sggltdeaalsccsdadpstkdfllqetmlrvkdpkksldfytrvlgmtliqkcdfpimk
    fslyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhngnsdprgfgh
    igiavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywiqilnpnkmatlm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bh5B (B:)
    aepqppsggltdeaalsccsdadpstkdfllqetmlrvkdpkksldfytrvlgmtliqkc
    dfpimkfslyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhngnsd
    prgfghigiavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywiqilnpnkma
    tlm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bh5B (B:)
    epqppsggltdeaalsccsdadpstkdfllqetmlrvkdpkksldfytrvlgmtliqkcd
    fpimkfslyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhngnsdp
    rgfghigiavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywiqilnpnkmat
    lm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bh5C (C:)
    aepqppsggltdeaalsccsdadpstkdfllqetmlrvkdpkksldfytrvlgmtliqkc
    dfpimkfslyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhngnsd
    prgfghigiavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywiqilnpnkma
    tlm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bh5C (C:)
    sggltdeaalsccsdadpstkdfllqetmlrvkdpkksldfytrvlgmtliqkcdfpimk
    fslyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhngnsdprgfgh
    igiavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywiqilnpnkmatlm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bh5D (D:)
    aepqppsggltdeaalsccsdadpstkdfllqetmlrvkdpkksldfytrvlgmtliqkc
    dfpimkfslyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhngnsd
    prgfghigiavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywiqilnpnkma
    tlm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bh5D (D:)
    epqppsggltdeaalsccsdadpstkdfllqetmlrvkdpkksldfytrvlgmtliqkcd
    fpimkfslyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhngnsdp
    rgfghigiavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywiqilnpnkmat
    lm