PDB entry 1bh4

View 1bh4 on RCSB PDB site
Description: circulin a from chassalia parviflora, nmr, 12 structures
Class: cyclic peptide
Keywords: cyclic peptide, cystine knot, anti-hiv activity
Deposited on 1998-06-12, released 1999-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-08-12, with a file datestamp of 2020-08-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: circulin a
  Species: Chassalia parviflora [TaxId:58431]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56871 (3-29)
  Domains in SCOPe 2.08: d1bh4a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bh4A (A:)
  cgescvwipcisaalgcscknkvcyrngip