PDB entry 1bh3

View 1bh3 on RCSB PDB site
Description: e1m, a116k mutant of rh. blastica porin
Class: membrane protein
Keywords: integral membrane protein, porin, pore eyelet mutant, membrane protein
Deposited on 1998-06-12, released 1998-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.153
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: porin
    Species: Rhodobacter blasticus [TaxId:1075]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39767 (1-288)
      • engineered (115)
    Domains in SCOPe 2.06: d1bh3a_
  • Heterogens: C8E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bh3A (A:)
    mislngygrfglqyvedrgvgledtiissrlrinivgttetdqgvtfgaklrmqwddgda
    fagtagnaaqfwtsyngvtvsvgnvdtafdsvaltydsemgyeassfgdaqssffkynsk
    ydasgaldnyngiavtysisgvnlylsyvdpdqtvdsslvteefgiaadwsndmislaaa
    yttdaggivdndiafvgaaykfndagtvglnwydnglstagdqvtlygnyafgattvray
    vsdidragadtaygigadyqfaegvkvsgsvqsgfanetvadvgvrfdf