PDB entry 1bh2

View 1bh2 on RCSB PDB site
Description: a326s mutant of an inhibitory alpha subunit
Class: signal transduction protein
Keywords: signal transduction protein
Deposited on 1998-06-12, released 1998-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanine nucleotide-binding protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10824 (0-314)
      • engineered mutation (294)
    Domains in SCOPe 2.07: d1bh2a1, d1bh2a2
  • Heterogens: MG, GSP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bh2A (A:)
    revkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramgrl
    kidfgdaaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsreyqlnds
    aayylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserkkw
    ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
    dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcstdtkn
    vqfvfdavtdviikn