PDB entry 1bgv

View 1bgv on RCSB PDB site
Description: glutamate dehydrogenase
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1998-06-01, released 1998-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.173
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate dehydrogenase
    Species: Clostridium symbiosum [TaxId:1512]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1bgva1, d1bgva2
  • Heterogens: GLU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bgvA (A:)
    skyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervief
    rvpweddngkvhvntgyrvqfngaigpykgglrfapsvnlsimkflgfeqafkdslttlp
    mggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygqy
    rkivggfyngvltgkarsfggslvrpeatgygsvyyveavmkhendtlvgktvalagfgn
    vawgaakklaelgakavtlsgpdgyiydpegitteekinymlemrasgrnkvqdyadkfg
    vqffpgekpwgqkvdiimpcatqndvdleqakkivannvkyyievanmpttnealrflmq
    qpnmvvapskavnaggvlvsgfemsqnserlswtaeevdsklhqvmtdihdgsaaaaery
    glgynlvaganivgfqkiadammaqgiaw