PDB entry 1bgt

View 1bgt on RCSB PDB site
Description: crystal structure of the DNA modifying enzyme beta-glucosyltransferase in the presence and absence of the substrate uridine diphosphoglucose
Class: transferase(glycosyltransferase)
Keywords: transferase(glycosyltransferase)
Deposited on 1994-06-09, released 1994-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucosyltransferase
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bgta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bgtA (A:)
    mkiaiinmgnnvinfktvpssetiylfkvisemglnvdiislkngvytksfdevdvndyd
    rlivvnssinffggkpnlailsaqkfmakykskiyylftdirlpfsqswpnvknrpwayl
    yteeellikspikvisqginldiakaahkkvdnviefeyfpieqykihmndfqlskptkk
    tldviyggsfrsgqreskmveflfdtglnieffgnarekqfknpkypwtkapvftgkipm
    nmvseknsqaiaaliigdknyndnfitlrvwetmasdavmlideefdtkhriindarfyv
    nnraelidrvnelkhsdvlrkemlsiqhdilnktrakkaewqdafkkaidl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bgtA (A:)
    mkiaiinmgnnvinfktvpssetiylfkvisemglnvdiislkngvytksfdevdvndyd
    rlivvnskpnlailsaqkfmakykskiyylftdirlpfsqeeellikspikvisqginld
    iakaahkkvdnviefeyfpieqykihmndfqlskptkktldviyggsfrsgqreskmvef
    lfdtglnieffgnarekqfknpkypwtkapvftgkipmnmvseknsqaiaaliigdknyn
    dnfitlrvwetmasdavmlideefdtkhriindarfyvnnraelidrvnelkhsdvlrke
    mlsiqhdilnktrakkaewqdafkkaidl