PDB entry 1bgr

View 1bgr on RCSB PDB site
Description: structure of diferric mare lactoferrin at 2.62 a resolution
Deposited on 1998-05-30, released 1998-10-28
The last revision was dated 1998-11-18, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: 0.196
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: FE, CO3, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1bgr_ (-)
    aprksvrwctispaeaakcarwqrnmkklgapsitcvrralvleciraiaekkadavtld
    ggmvyeagldpyklrpvaaeiygatkespqthyyavavvkkgsnfqldqlqgrkschtgl
    grsagwnipmgilrpylswtesleplqgavakffsascvpcvdrqaypnlcqlckgegen
    qcacssrepyfgysgafkclqdgagdvafvkettvfenlpekadrdqyellcpnntrkpv
    dafkechlaqvpshavvarsvdgkedliwkllqkaqekfgknksgsfqlfgsppgqqdll
    fkdsalgflripskidsalylgsnylttlknlretaeevqarrervlwcavgpeeqnkcq
    qwsqssgqivtcatasttddcialvlkgeadalsldggyiytagkcglvpvlaenrkssk
    hssldcvlrptegylavavvkkanagltwnslkakkschtavdrtagwnipmglifnqtg
    scafdeffsqscvpgadpksrlcalcagddqgldkclpnskekyygytgafrclaedvgd
    vafvkndtvwentngestadwaknlnasdfrllcldgtrkpvtegqschlamapnhavvs
    rseraahvqqvllhqqalfgengkncpdkfclfksetknllfndnteclaelqgkttyeq
    ylgseyvtsitnlrrcsssplleacaflra
    

  • Chain 'p':
    No sequence available.