PDB entry 1bgo

View 1bgo on RCSB PDB site
Description: crystal structure of cysteine protease human cathepsin k in complex with a covalent peptidomimetic inhibitor
Class: hydrolase
Keywords: hydrolase, sulfhydryl proteinase, thiol protease
Deposited on 1998-05-29, released 1999-06-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.24
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cathepsin k
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43235 (0-214)
  Domains in SCOPe 2.01: d1bgoa_
• Heterogens: I10, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bgoA (A:)
  apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
  dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
  lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
  knswgenwgnkgyilmarnknnacgianlasfpkm