PDB entry 1bgo

View 1bgo on RCSB PDB site
Description: crystal structure of cysteine protease human cathepsin k in complex with a covalent peptidomimetic inhibitor
Class: hydrolase
Keywords: hydrolase, sulfhydryl proteinase, thiol protease
Deposited on 1998-05-29, released 1999-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.24
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin k
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bgoa_
  • Heterogens: I10, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bgoA (A:)
    apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
    dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
    lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
    knswgenwgnkgyilmarnknnacgianlasfpkm