PDB entry 1bgm

View 1bgm on RCSB PDB site
Description: beta-galactosidase (chains i-p)
Deposited on 1994-07-18, released 1995-12-07
The last revision prior to the SCOP 1.61 freeze date was dated 1995-12-07, with a file datestamp of 1995-12-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.174
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bgmI (I:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bgmJ (J:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bgmK (K:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bgmL (L:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bgmM (M:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bgmN (N:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bgmO (O:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bgmP (P:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k