PDB entry 1bgl

View 1bgl on RCSB PDB site
Description: beta-galactosidase (chains a-h)
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1994-07-18, released 1995-12-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.174
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bglA (A:)
    tmitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bglA (A:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bglB (B:)
    tmitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bglB (B:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bglC (C:)
    tmitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bglC (C:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bglD (D:)
    tmitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bglD (D:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1bglE (E:)
    tmitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bglE (E:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1bglF (F:)
    tmitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bglF (F:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1bglG (G:)
    tmitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bglG (G:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1bglH (H:)
    tmitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bglH (H:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k