PDB entry 1bgk

View 1bgk on RCSB PDB site
Description: sea anemone toxin (bgk) with high affinity for voltage dependent potassium channel, nmr, 15 structures
Class: potassium channel inhibitor
Keywords: neurotoxin, potassium channel inhibitor
Deposited on 1996-05-08, released 1997-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: bgk
  Species: Bunodosoma granulifera [TaxId:31164]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29186 (0-36)
  Domains in SCOPe 2.08: d1bgka_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bgkA (A:)
  vcrdwfketacrhakslgncrtsqkyrancaktcelc