PDB entry 1bgj

View 1bgj on RCSB PDB site
Description: p-hydroxybenzoate hydroxylase (phbh) mutant with cys 116 replaced by ser (c116s) and his 162 replaced by arg (h162r), in complex with fad and 4-hydroxybenzoic acid
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1998-05-29, released 1998-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p-hydroxybenzoate hydroxylase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: POBA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00438 (0-End)
      • engineered (115)
      • engineered (161)
    Domains in SCOPe 2.07: d1bgja1, d1bgja2
  • Heterogens: FAD, PHB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bgjA (A:)
    mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgriragvleqgmvdllreag
    vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareasgatt
    vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfrgisrqsipaerlkvferv
    ypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvpltekvedwsderfw
    telkarlpaevaeklvtgpsleksiaplrsfvvepmqhgrlflagdaahivpptgakgln
    laasdvstlyrlllkayregrgellerysaiclrriwkaerfswwmtsvlhrfpdtdafs
    qriqqteleyylgseaglatiaenyvglpyeeie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bgjA (A:)
    mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgriragvleqgmvdllreag
    vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareasgatt
    vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfrgisrqsipaerlkvferv
    ypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvpltekvedwsderfw
    telkarlpaevaeklvtgpsleksiaplrsfvvepmqhgrlflagdaahivpptgakgln
    laasdvstlyrlllkayregrgellerysaiclrriwkaerfswwmtsvlhrfpdtdafs
    qriqqteleyylgseaglatiaenyvglpye