PDB entry 1bgh

View 1bgh on RCSB PDB site
Description: structure of the gene v protein of bacteriophage f1 determined by multiwavelength x-ray diffraction on the selenomethionyl protein
Deposited on 1993-08-03, released 1993-10-31
The last revision was dated 1993-10-31, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1bgh_ (-)
ikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgneypvlvkitldegqpayapgly
tvhlssfkvgqfgslmidrlrlvpa

  • Chain 'p':
    No sequence available.