PDB entry 1bgg

View 1bgg on RCSB PDB site
Description: glucosidase a from bacillus polymyxa complexed with gluconate
Deposited on 1997-05-12, released 1998-05-27
The last revision prior to the SCOP 1.65 freeze date was dated 1998-05-27, with a file datestamp of 1998-05-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1bgga_
  • Chain 'B':
    Domains in SCOP 1.65: d1bggb_
  • Chain 'C':
    Domains in SCOP 1.65: d1bggc_
  • Chain 'D':
    Domains in SCOP 1.65: d1bggd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bggA (A:)
    mtifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhr
    yeedirlmkelgirtyrfsvswprifpngdgevnqegldyyhrvvdllndngiepfctly
    hwdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvh
    apgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaaca
    rtislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsv
    nrfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacinde
    vvngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvd
    frtqvrtpkesyywyrnvvsnnwletrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bggA (A:)
    tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
    eedirlmkelgirtyrfsvswprifpngdgevnqegldyyhrvvdllndngiepfctlyh
    wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
    pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
    tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
    rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
    vngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvdf
    rtqvrtpkesyywyrnvvsnnwletrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bggB (B:)
    mtifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhr
    yeedirlmkelgirtyrfsvswprifpngdgevnqegldyyhrvvdllndngiepfctly
    hwdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvh
    apgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaaca
    rtislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsv
    nrfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacinde
    vvngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvd
    frtqvrtpkesyywyrnvvsnnwletrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bggB (B:)
    tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
    eedirlmkelgirtyrfsvswprifpngdgevnqegldyyhrvvdllndngiepfctlyh
    wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
    pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
    tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
    rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
    vngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvdf
    rtqvrtpkesyywyrnvvsnnwletrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bggC (C:)
    mtifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhr
    yeedirlmkelgirtyrfsvswprifpngdgevnqegldyyhrvvdllndngiepfctly
    hwdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvh
    apgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaaca
    rtislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsv
    nrfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacinde
    vvngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvd
    frtqvrtpkesyywyrnvvsnnwletrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bggC (C:)
    tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
    eedirlmkelgirtyrfsvswprifpngdgevnqegldyyhrvvdllndngiepfctlyh
    wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
    pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
    tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
    rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
    vngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvdf
    rtqvrtpkesyywyrnvvsnnwletrr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bggD (D:)
    mtifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhr
    yeedirlmkelgirtyrfsvswprifpngdgevnqegldyyhrvvdllndngiepfctly
    hwdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvh
    apgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaaca
    rtislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsv
    nrfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacinde
    vvngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvd
    frtqvrtpkesyywyrnvvsnnwletrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bggD (D:)
    tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
    eedirlmkelgirtyrfsvswprifpngdgevnqegldyyhrvvdllndngiepfctlyh
    wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
    pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
    tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
    rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
    vngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvdf
    rtqvrtpkesyywyrnvvsnnwletrr