PDB entry 1bgg

View 1bgg on RCSB PDB site
Description: glucosidase a from bacillus polymyxa complexed with gluconate
Class: family 1 beta-glucosidase complex
Keywords: family 1 beta-glucosidase complex, glycosyl-hydrolase complex
Deposited on 1997-05-12, released 1998-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucosidase a
    Species: Paenibacillus polymyxa [TaxId:1406]
    Gene: BGLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bgga_
  • Chain 'B':
    Compound: beta-glucosidase a
    Species: Paenibacillus polymyxa [TaxId:1406]
    Gene: BGLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bggb_
  • Chain 'C':
    Compound: beta-glucosidase a
    Species: Paenibacillus polymyxa [TaxId:1406]
    Gene: BGLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bggc_
  • Chain 'D':
    Compound: beta-glucosidase a
    Species: Paenibacillus polymyxa [TaxId:1406]
    Gene: BGLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bggd_
  • Heterogens: GCO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bggA (A:)
    mtifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhr
    yeedirlmkelgirtyrfsvswprifpngdgevnqegldyyhrvvdllndngiepfctly
    hwdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvh
    apgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaaca
    rtislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsv
    nrfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacinde
    vvngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvd
    frtqvrtpkesyywyrnvvsnnwletrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bggA (A:)
    tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
    eedirlmkelgirtyrfsvswprifpngdgevnqegldyyhrvvdllndngiepfctlyh
    wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
    pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
    tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
    rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
    vngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvdf
    rtqvrtpkesyywyrnvvsnnwletrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bggB (B:)
    mtifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhr
    yeedirlmkelgirtyrfsvswprifpngdgevnqegldyyhrvvdllndngiepfctly
    hwdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvh
    apgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaaca
    rtislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsv
    nrfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacinde
    vvngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvd
    frtqvrtpkesyywyrnvvsnnwletrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bggB (B:)
    tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
    eedirlmkelgirtyrfsvswprifpngdgevnqegldyyhrvvdllndngiepfctlyh
    wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
    pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
    tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
    rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
    vngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvdf
    rtqvrtpkesyywyrnvvsnnwletrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bggC (C:)
    mtifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhr
    yeedirlmkelgirtyrfsvswprifpngdgevnqegldyyhrvvdllndngiepfctly
    hwdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvh
    apgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaaca
    rtislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsv
    nrfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacinde
    vvngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvd
    frtqvrtpkesyywyrnvvsnnwletrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bggC (C:)
    tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
    eedirlmkelgirtyrfsvswprifpngdgevnqegldyyhrvvdllndngiepfctlyh
    wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
    pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
    tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
    rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
    vngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvdf
    rtqvrtpkesyywyrnvvsnnwletrr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bggD (D:)
    mtifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhr
    yeedirlmkelgirtyrfsvswprifpngdgevnqegldyyhrvvdllndngiepfctly
    hwdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvh
    apgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaaca
    rtislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsv
    nrfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacinde
    vvngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvd
    frtqvrtpkesyywyrnvvsnnwletrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bggD (D:)
    tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
    eedirlmkelgirtyrfsvswprifpngdgevnqegldyyhrvvdllndngiepfctlyh
    wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
    pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
    tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
    rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
    vngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvdf
    rtqvrtpkesyywyrnvvsnnwletrr