PDB entry 1bgc

View 1bgc on RCSB PDB site
Description: crystal structure of canine and bovine granulocyte-colony stimulating factor (g-csf)
Class: cytokine
Keywords: cytokine
Deposited on 1993-04-27, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.213
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: granulocyte colony-stimulating factor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bgca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bgcA (A:)
    tplgparslpqsfllkcleqvrkiqadgaelqerlcaahklchpeelmllrhslgipqap
    lsscssqslqlrgclnqlhgglflyqgllqalagispelaptldtlqldvtdfatniwlq
    medlgaapavqptqgamptftsafqrraggvlvasqlhrflelayrglrylaep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bgcA (A:)
    slpqsfllkcleqvrkiqadgaelqerlcaahklchpeelmllrhslgipqaplsscssq
    slqlrgclnqlhgglflyqgllqalagispelaptldtlqldvtdfatniwlqmedlgaa
    pamptftsafqrraggvlvasqlhrflelayrglryla