PDB entry 1bg7

View 1bg7 on RCSB PDB site
Description: localized unfolding at the junction of three ferritin subunits. a mechanism for iron release?
Deposited on 1998-06-05, released 1999-01-13
The last revision prior to the SCOP 1.55 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.207
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1bg7__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1bg7_ (-)
    dsqvrqnfhrdceaainrmvnmelyasytylsmafyfdrddialhnvakffkeqsheere
    haeklmkdqnkrggrivlqdvqkperdewgntleamqaalqlektvnqalldlhkvgsdk
    vdphlcdfleteypeeqvksikqlgdyitnlkrlglpqngmgeylfdkhtmge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bg7_ (-)
    dsqvrqnfhrdceaainrmvnmelyasytylsmafyfdrddialhnvakffkeqsheere
    haeklmkdqnkrggrivlqdvqkperdewgntleamqaalqlektvnqalldlpeeqvks
    ikqlgdyitnlkrlglpqngmgeylfdkhtmge