PDB entry 1bg6

View 1bg6 on RCSB PDB site
Description: crystal structure of the n-(1-d-carboxylethyl)-l-norvaline dehydrogenase from arthrobacter sp. strain 1c
Deposited on 1998-06-05, released 1999-01-13
The last revision prior to the SCOP 1.55 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1bg6_ (-)
    sktyavlglgngghafaaylalkgqsvlawdidaqrikeiqdrgaiiaegpglagtahpd
    lltsdiglavkdadvilivvpaihhasiaaniasyisegqliilnpgatggalefrkilr
    engapevtigetssmlftcrserpgqvtvnaikgamdfaclpaakagwaleqigsvlpqy
    vavenvlhtsltnvnavmhplptllnaarcesgtpfqyylegitpsvgslaekvdaeria
    iakafdlnvpsvcewykesygqspatiyeavqgnpayrgiagpinlntryffedvstglv
    plselgravnvptplidavldlisslidtdfrkegrtleklglsgltaagirsave
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bg6_ (-)
    sktyavlglgngghafaaylalkgqsvlawdidaqrikeiqdrgaiiaegpglagtahpd
    lltsdiglavkdadvilivvpaihhasiaaniasyisegqliilnpgatggalefrkilr
    engapevtigetssmlftcrserpgqvtvnaikgamdfaclpaakagwaleqigsvlpqy
    vavenvlhtsltnvnavmhplptllnaarcesgtpfqyylegitpsvgslaekvdaeria
    iakafdlnvpsvcewypatiyeavqgnpayrgiagpinlntryffedvstglvplselgr
    avnvptplidavldlisslidtdfrkegrtleklglsgltaagirsave