PDB entry 1bg6

View 1bg6 on RCSB PDB site
Description: crystal structure of the n-(1-d-carboxylethyl)-l-norvaline dehydrogenase from arthrobacter sp. strain 1c
Class: oxidoreductase
Keywords: (d, l) stereospecific opine dehydrogenase, oxidoreductase
Deposited on 1998-06-05, released 1999-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n-(1-d-carboxylethyl)-l-norvaline dehydrogenase
    Species: Arthrobacter sp. [TaxId:79670]
    Gene: ODH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bg6a1, d1bg6a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bg6A (A:)
    miesktyavlglgngghafaaylalkgqsvlawdidaqrikeiqdrgaiiaegpglagta
    hpdlltsdiglavkdadvilivvpaihhasiaaniasyisegqliilnpgatggalefrk
    ilrengapevtigetssmlftcrserpgqvtvnaikgamdfaclpaakagwaleqigsvl
    pqyvavenvlhtsltnvnavmhplptllnaarcesgtpfqyylegitpsvgslaekvdae
    riaiakafdlnvpsvcewykesygqspatiyeavqgnpayrgiagpinlntryffedvst
    glvplselgravnvptplidavldlisslidtdfrkegrtleklglsgltaagirsave
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bg6A (A:)
    sktyavlglgngghafaaylalkgqsvlawdidaqrikeiqdrgaiiaegpglagtahpd
    lltsdiglavkdadvilivvpaihhasiaaniasyisegqliilnpgatggalefrkilr
    engapevtigetssmlftcrserpgqvtvnaikgamdfaclpaakagwaleqigsvlpqy
    vavenvlhtsltnvnavmhplptllnaarcesgtpfqyylegitpsvgslaekvdaeria
    iakafdlnvpsvcewypatiyeavqgnpayrgiagpinlntryffedvstglvplselgr
    avnvptplidavldlisslidtdfrkegrtleklglsgltaagirsave