PDB entry 1bg5

View 1bg5 on RCSB PDB site
Description: crystal structure of the ankyrin binding domain of alpha-na,k-ATPase as a fusion protein with glutathione s-transferase
Class: ankyrin binding
Keywords: ankyrin binding, ATPase, glutathione-s-transferase, carrier crystallization, ion transport
Deposited on 1998-06-05, released 1999-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.193
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fusion protein of alpha-na,k-ATPase with glutathione s-transferase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bg5a1, d1bg5a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bg5A (A:)
    mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqatfgggdhppksdlvprgssyyqeaksskimes
    fknmvpqqalvnss