PDB entry 1bg4

View 1bg4 on RCSB PDB site
Description: xylanase from penicillium simplicissimum
Class: family 10 xylanase
Keywords: family 10 xylanase, penicillium simplicissimum, tim-barrel, glycosyl hydrolase
Deposited on 1998-06-05, released 1998-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.2
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: Penicillium simplicissimum [TaxId:69488]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bg4a_
  • Heterogens: NA, TRS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bg4A (A:)
    easvsidakfkahgkkylgtigdqytltkntknpaiikadfgqltpensmkwdatepnrg
    qftfsgsdylvnfaqsngklirghtlvwhsqlpgwvssitdkntlisvlknhittvmtry
    kgkiyawdvlneifnedgslrnsvfynvigedyvriafetarsvdpnaklyindynldsa
    gyskvngmvshvkkwlaagipidgigsqthlgagagsavagalnalasagtkeiaiteld
    iagasstdyvnvvnaclnqakcvgitvwgvadpdswrsssspllfdgnynpkaaynaian
    al