PDB entry 1bg3

View 1bg3 on RCSB PDB site
Description: rat brain hexokinase type I complex with glucose and inhibitor glucose-6-phosphate
Class: hexokinase
Keywords: hexokinase, phosphotransferase
Deposited on 1998-06-04, released 1999-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.196
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bg3A (A:)
    miaaqllayyftelkddqvkkidkylyamrlsdeilidiltrfkkemknglsrdynptas
    vkmlptfvrsipdgsekgdfialdlggssfrilrvqvnheknqnvsmeseiydtpenivh
    gsgtqlfdhvadclgdfmekkkikdkklpvgftfsfpcrqskideavlitwtkrfkasgv
    egadvvkllnkaikkrgdydanivavvndtvgtmmtcgyddqqcevgliigtgtnacyme
    elrhidlvegdegrmcintewgafgddgsledirtefdreldrgslnpgkqlfekmvsgm
    ymgelvrlilvkmakegllfegritpelltrgkfntsdvsaiekdkegiqnakeiltrlg
    vepsdvdcvsvqhictivsfrsanlvaatlgailnrlrdnkgtprlrttvgvdgslykmh
    pqysrrfhktlrrlvpdsdvrfllsesgtgkgaamvtavayrlaeqhrqieetlahfrls
    kqtlmevkkrlrtememglrketnskatvkmlpsfvrsipdgtehgdflaldlggtnfrv
    llvkirsgkkrtvemhnkiysipleimqgtgdelfdhivscisdfldymgikgprmplgf
    tfsfpchqtnldcgiliswtkgfkatdceghdvasllrdavkrreefdldvvavvndtvg
    tmmtcayeeptceiglivgtgtnacymeemknvemvegnqgqmcinmewgafgdngcldd
    irtdfdkvvdeyslnsgkqrfekmisgmylgeivrnilidftkkgflfrgqiseplktrg
    ifetkflsqiesdrlallqvrailqqlglnstcddsilvktvcgvvskraaqlcgagmaa
    vvekirenrgldhlnvtvgvdgtlyklhphfsrimhqtvkelspkctvsfllsedgsgkg
    aalitavgvrlrgdpsia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bg3A (A:)
    miaaqllayyftelkddqvkkidkylyamrlsdeilidiltrfkkemknglsrdynptas
    vkmlptfvrsipdgsekgdfialdlggssfrilrvqvnvsmeseiydtpenivhgsgtql
    fdhvadclgdfmekkkikdkklpvgftfsfpcrqskideavlitwtkrfkasgvegadvv
    kllnkaikkrgdydanivavvndtvgtmmtcgyddqqcevgliigtgtnacymeelrhid
    lvegdegrmcintewgafgddgsledirtefdreldrgslnpgkqlfekmvsgmymgelv
    rlilvkmakegllfegritpelltrgkfntsdvsaiekdkegiqnakeiltrlgvepsdv
    dcvsvqhictivsfrsanlvaatlgailnrlrdnkgtprlrttvgvdgslykmhpqysrr
    fhktlrrlvpdsdvrfllsesgtgkgaamvtavayrlaeqhrqieetlahfrlskqtlme
    vkkrlrtememglrketnskatvkmlpsfvrsipdgtehgdflaldlggtnfrvllvkir
    srtvemhnkiysipleimqgtgdelfdhivscisdfldymgikgprmplgftfsfpchqt
    nldcgiliswtkgfkatdceghdvasllrdavkrreefdldvvavvndtvgtmmtcayee
    ptceiglivgtgtnacymeemknvemvegnqgqmcinmewgafgdngclddirtdfdkvv
    deyslnsgkqrfekmisgmylgeivrnilidftkkgflfrgqiseplktrgifetkflsq
    iesdrlallqvrailqqlglnstcddsilvktvcgvvskraaqlcgagmaavvekirenr
    gldhlnvtvgvdgtlyklhphfsrimhqtvkelspkctvsfllsedgsgkgaalitavgv
    rl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bg3B (B:)
    miaaqllayyftelkddqvkkidkylyamrlsdeilidiltrfkkemknglsrdynptas
    vkmlptfvrsipdgsekgdfialdlggssfrilrvqvnheknqnvsmeseiydtpenivh
    gsgtqlfdhvadclgdfmekkkikdkklpvgftfsfpcrqskideavlitwtkrfkasgv
    egadvvkllnkaikkrgdydanivavvndtvgtmmtcgyddqqcevgliigtgtnacyme
    elrhidlvegdegrmcintewgafgddgsledirtefdreldrgslnpgkqlfekmvsgm
    ymgelvrlilvkmakegllfegritpelltrgkfntsdvsaiekdkegiqnakeiltrlg
    vepsdvdcvsvqhictivsfrsanlvaatlgailnrlrdnkgtprlrttvgvdgslykmh
    pqysrrfhktlrrlvpdsdvrfllsesgtgkgaamvtavayrlaeqhrqieetlahfrls
    kqtlmevkkrlrtememglrketnskatvkmlpsfvrsipdgtehgdflaldlggtnfrv
    llvkirsgkkrtvemhnkiysipleimqgtgdelfdhivscisdfldymgikgprmplgf
    tfsfpchqtnldcgiliswtkgfkatdceghdvasllrdavkrreefdldvvavvndtvg
    tmmtcayeeptceiglivgtgtnacymeemknvemvegnqgqmcinmewgafgdngcldd
    irtdfdkvvdeyslnsgkqrfekmisgmylgeivrnilidftkkgflfrgqiseplktrg
    ifetkflsqiesdrlallqvrailqqlglnstcddsilvktvcgvvskraaqlcgagmaa
    vvekirenrgldhlnvtvgvdgtlyklhphfsrimhqtvkelspkctvsfllsedgsgkg
    aalitavgvrlrgdpsia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bg3B (B:)
    miaaqllayyftelkddqvkkidkylyamrlsdeilidiltrfkkemknglsrdynptas
    vkmlptfvrsipdgsekgdfialdlggssfrilrvqvnvsmeseiydtpenivhgsgtql
    fdhvadclgdfmekkdkklpvgftfsfpcrqskideavlitwtkrfkasgvegadvvkll
    nkaikkrgdydanivavvndtvgtmmtcgyddqqcevgliigtgtnacymeelrhidlve
    gdegrmcintewgafgddgsledirtefdreldrgslnpgkqlfekmvsgmymgelvrli
    lvkmakegllfegritpelltrgkfntsdvsaiekdkegiqnakeiltrlgvepsdvdcv
    svqhictivsfrsanlvaatlgailnrlrdnkgtprlrttvgvdgslykmhpqysrrfhk
    tlrrlvpdsdvrfllsesgtgkgaamvtavayrlaeqhrqieetlahfrlskqtlmevkk
    rlrtememglrketnskatvkmlpsfvrsipdgtehgdflaldlggtnfrvllvkirsgk
    krtvemhnkiysipleimqgtgdelfdhivscisdfldymgikgprmplgftfsfpchqt
    nldcgiliswtkgfkatdceghdvasllrdavkrreefdldvvavvndtvgtmmtcayee
    ptceiglivgtgtnacymeemknvemvegnqgqmcinmewgafgdngclddirtdfdkvv
    deyslnsgkqrfekmisgmylgeivrnilidftkkgflfrgqiseplktrgifetkflsq
    iesdrlallqvrailqqlglnstcddsilvktvcgvvskraaqlcgagmaavvekirenr
    gldhlnvtvgvdgtlyklhphfsrimhqtvkelspkctvsfllsedgsgkgaalitavgv
    rl