PDB entry 1bg2

View 1bg2 on RCSB PDB site
Description: human ubiquitous kinesin motor domain
Class: motor protein
Keywords: motor protein, ATPase, microtubule associated
Deposited on 1998-06-04, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.216
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kinesin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bg2a_
  • Heterogens: MG, ACT, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bg2A (A:)
    madlaecnikvmcrfrplnesevnrgdkyiakfqgedtvviaskpyafdrvfqsstsqeq
    vyndcakkivkdvlegyngtifaygqtssgkthtmegklhdpegmgiiprivqdifnyiy
    smdenlefhikvsyfeiyldkirdlldvsktnlsvhedknrvpyvkgcterfvcspdevm
    dtidegksnrhvavtnmnehssrshsiflinvkqentqteqklsgklylvdlagsekvsk
    tgaegavldeakninkslsalgnvisalaegstyvpyrdskmtrilqdslggncrttivi
    ccspssynesetkstllfgqrakti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bg2A (A:)
    dlaecnikvmcrfrplnesevnrgdkyiakfqgedtvviaskpyafdrvfqsstsqeqvy
    ndcakkivkdvlegyngtifaygqtssgkthtmegklhdpegmgiiprivqdifnyiysm
    denlefhikvsyfeiyldkirdlldvsktnlsvhedknrvpyvkgcterfvcspdevmdt
    idegksnrhvavtnmnehssrshsiflinvkqentqteqklsgklylvdlagsekvsktg
    aegavldeakninkslsalgnvisalaegstyvpyrdskmtrilqdslggncrttivicc
    spssynesetkstllfgqrakti