PDB entry 1bg1

View 1bg1 on RCSB PDB site
Description: transcription factor stat3b/DNA complex
Class: transcription/DNA
Keywords: transcription factor, protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex
Deposited on 1998-06-03, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-23.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.246
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (transcription factor stat3b)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42227
      • conflict (504)
      • modified residue (578)
    Domains in SCOPe 2.07: d1bg1a1, d1bg1a2, d1bg1a3
  • Chain 'B':
    Compound: DNA (5'-d(*tp*gp*cp*ap*tp*tp*tp*cp*cp*cp*gp*tp*ap*ap*ap*tp*cp*t)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bg1A (A:)
    gqanhptaavvtekqqmleqhlqdvrkrvqdleqkmkvvenlqddfdfnyktlksqgdmq
    dlngnnqsvtrqkmqqleqmltaldqmrrsivselagllsameyvqktltdeeladwkrr
    qqiaciggppnicldrlenwitslaesqlqtrqqikkleelqqkvsykgdpivqhrpmle
    erivelfrnlmksafvverqpcmpmhpdrplviktgvqfttkvrllvkfpelnyqlkikv
    cidkdsgdvaalrgsrkfnilgtntkvmnmeesnngslsaefkhltlreqrcgnggranc
    daslivteelhlitfetevyhqglkidlethslpvvvisnicqmpnawasilwynmltnn
    pknvnfftkppigtwdqvaevlswqfssttkrglsieqlttlaekllgpgvnysgcqitw
    akfckenmagkgfsfwvwldniidlvkkyilalwnegyimgfiskererailstkppgtf
    llrfsesskeggvtftwvekdisgstqiqsvepytkqqlnnmsfaeiimgykimdatnil
    vsplvylypdipkeeafgkycrpesqehpeadpgsaapylktkficvtpfidavwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bg1A (A:)
    vvtekqqmleqhlqdvrkrvqdleqkmkvvenlqddfdfnyktlksqgdsvtrqkmqqle
    qmltaldqmrrsivselagllsameyvqktltdeeladwkrrqqiaciggppnicldrle
    nwitslaesqlqtrqqikkleelqqkvsykgdpivqhrpmleerivelfrnlmksafvve
    rqpcmpmhpdrplviktgvqfttkvrllvkfpelnyqlkikvcidkdsgdvaalrgsrkf
    nilgtntkvmnmeesnngslsaefkhltlreqrcgnggrancdaslivteelhlitfete
    vyhqglkidlethslpvvvisnicqmpnawasilwynmltnnpknvnfftkppigtwdqv
    aevlswqfssttkrglsieqlttlaekllgpgvnysgcqitwakfckenmagkgfsfwvw
    ldniidlvkkyilalwnegyimgfiskererailstkppgtfllrfsesskeggvtftwv
    ekdisgstqiqsvepytkqqlnnmsfaeiimgykimdatnilvsplvylypdipkeeafg
    kycraapylktkficvtpf
    

  • Chain 'B':
    No sequence available.