PDB entry 1bfy

View 1bfy on RCSB PDB site
Description: solution structure of reduced clostridium pasteurianum rubredoxin, nmr, 20 structures
Class: electron transport
Keywords: electron transport, rubredoxin, solution structure, paramagnetism, nuclear relaxation
Deposited on 1998-05-23, released 1999-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bfya_
  • Heterogens: FE

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bfyA (A:)
    mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgvgkdqfeevee