PDB entry 1bfs

View 1bfs on RCSB PDB site
Description: structure of nf-kb p50 homodimer bound to a kb site
Class: transcription factor
Keywords: transcription factor, nf-kb, dimerization domain
Deposited on 1997-09-12, released 1998-01-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.183
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nuclear factor nf-kappa-b p50
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bfsa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bfsA (A:)
    asnlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvh
    rqfaivfktpkykdvnitkpasvfvqlrrksdletsepkpflyype