PDB entry 1bfo

View 1bfo on RCSB PDB site
Description: campath-1g igg2b rat monoclonal fab
Class: antibody
Keywords: antibody, fab, campath-1g, cd52
Deposited on 1998-05-20, released 1999-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.192
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: campath-1g antibody
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed):
    • GB AAD10133 (0-213)
      • conflict (2)
      • conflict (20)
      • conflict (29)
      • conflict (42)
      • conflict (45)
      • conflict (50)
      • conflict (70)
      • conflict (72)
      • conflict (82)
      • conflict (91)
      • conflict (93)
      • conflict (95)
      • conflict (99)
      • conflict (109)
      • conflict (121)
      • conflict (125-126)
      • conflict (130)
      • conflict (134-135)
      • conflict (137)
      • conflict (152)
      • conflict (155)
      • conflict (159)
      • conflict (167)
      • conflict (182-183)
      • conflict (185-186)
      • conflict (193)
      • insertion (205)
      • conflict (207)
    Domains in SCOPe 2.07: d1bfoa1, d1bfoa2
  • Chain 'B':
    Compound: campath-1g antibody
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed):
    • GB AAA91896 (0-214)
      • conflict (23)
      • conflict (52)
      • conflict (55)
      • conflict (100-107)
      • conflict (109)
      • conflict (114-115)
      • conflict (122)
      • conflict (135-140)
      • conflict (142)
      • conflict (169)
      • conflict (194)
      • conflict (197)
    Domains in SCOPe 2.07: d1bfob1, d1bfob2
  • Chain 'C':
    Compound: campath-1g antibody
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed):
    • GB AAD10133 (0-213)
      • conflict (2)
      • conflict (20)
      • conflict (29)
      • conflict (42)
      • conflict (45)
      • conflict (50)
      • conflict (70)
      • conflict (72)
      • conflict (82)
      • conflict (91)
      • conflict (93)
      • conflict (95)
      • conflict (99)
      • conflict (109)
      • conflict (121)
      • conflict (125-126)
      • conflict (130)
      • conflict (134-135)
      • conflict (137)
      • conflict (152)
      • conflict (155)
      • conflict (159)
      • conflict (167)
      • conflict (182-183)
      • conflict (185-186)
      • conflict (193)
      • insertion (205)
      • conflict (207)
    Domains in SCOPe 2.07: d1bfoc1, d1bfoc2
  • Chain 'D':
    Compound: campath-1g antibody
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed):
    • GB AAA91896 (0-214)
      • conflict (23)
      • conflict (52)
      • conflict (55)
      • conflict (100-107)
      • conflict (109)
      • conflict (114-115)
      • conflict (122)
      • conflict (135-140)
      • conflict (142)
      • conflict (169)
      • conflict (194)
      • conflict (197)
    Domains in SCOPe 2.07: d1bfod1, d1bfod2
  • Chain 'E':
    Compound: campath-1g antibody
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed):
    • GB AAD10133 (0-213)
      • conflict (2)
      • conflict (20)
      • conflict (29)
      • conflict (42)
      • conflict (45)
      • conflict (50)
      • conflict (70)
      • conflict (72)
      • conflict (82)
      • conflict (91)
      • conflict (93)
      • conflict (95)
      • conflict (99)
      • conflict (109)
      • conflict (121)
      • conflict (125-126)
      • conflict (130)
      • conflict (134-135)
      • conflict (137)
      • conflict (152)
      • conflict (155)
      • conflict (159)
      • conflict (167)
      • conflict (182-183)
      • conflict (185-186)
      • conflict (193)
      • insertion (205)
      • conflict (207)
    Domains in SCOPe 2.07: d1bfoe1, d1bfoe2
  • Chain 'F':
    Compound: campath-1g antibody
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed):
    • GB AAA91896 (0-214)
      • conflict (23)
      • conflict (52)
      • conflict (55)
      • conflict (100-107)
      • conflict (109)
      • conflict (114-115)
      • conflict (122)
      • conflict (135-140)
      • conflict (142)
      • conflict (169)
      • conflict (194)
      • conflict (197)
    Domains in SCOPe 2.07: d1bfof1, d1bfof2
  • Chain 'G':
    Compound: campath-1g antibody
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed):
    • GB AAD10133 (0-213)
      • conflict (2)
      • conflict (20)
      • conflict (29)
      • conflict (42)
      • conflict (45)
      • conflict (50)
      • conflict (70)
      • conflict (72)
      • conflict (82)
      • conflict (91)
      • conflict (93)
      • conflict (95)
      • conflict (99)
      • conflict (109)
      • conflict (121)
      • conflict (125-126)
      • conflict (130)
      • conflict (134-135)
      • conflict (137)
      • conflict (152)
      • conflict (155)
      • conflict (159)
      • conflict (167)
      • conflict (182-183)
      • conflict (185-186)
      • conflict (193)
      • insertion (205)
      • conflict (207)
    Domains in SCOPe 2.07: d1bfog1, d1bfog2
  • Chain 'H':
    Compound: campath-1g antibody
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed):
    • GB AAA91896 (0-214)
      • conflict (23)
      • conflict (52)
      • conflict (55)
      • conflict (100-107)
      • conflict (109)
      • conflict (114-115)
      • conflict (122)
      • conflict (135-140)
      • conflict (142)
      • conflict (169)
      • conflict (194)
      • conflict (197)
    Domains in SCOPe 2.07: d1bfoh1, d1bfoh2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bfoA (A:)
    dikmtqspsflsasvgdrvtlnckasqnidkylnwyqqklgespklliyntnnlqtgips
    rfsgsgsgtdftltisslqpedvatyfclqhisrprtfgtgtklelkranaaptvsifpp
    steqlatggasvvclmnkfyprdisvkwkidgterngvlnsvtdqdsadstysmsstlsl
    tkadyqshnlytcqvvhktssspvvaknfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bfoB (B:)
    evkllesggglvqpggsmrlscagsgftftdfymnwirqpagkapewlgfirdkakgytt
    eynpsvkgrftisrdntqnmlylqmntlraedtatyycareghtaapfdywgqgvmvtvs
    saqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqs
    glytltssvtsstwpsqtvtcnvahpasstkvdkkv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bfoC (C:)
    dikmtqspsflsasvgdrvtlnckasqnidkylnwyqqklgespklliyntnnlqtgips
    rfsgsgsgtdftltisslqpedvatyfclqhisrprtfgtgtklelkranaaptvsifpp
    steqlatggasvvclmnkfyprdisvkwkidgterngvlnsvtdqdsadstysmsstlsl
    tkadyqshnlytcqvvhktssspvvaknfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bfoD (D:)
    evkllesggglvqpggsmrlscagsgftftdfymnwirqpagkapewlgfirdkakgytt
    eynpsvkgrftisrdntqnmlylqmntlraedtatyycareghtaapfdywgqgvmvtvs
    saqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqs
    glytltssvtsstwpsqtvtcnvahpasstkvdkkv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bfoE (E:)
    dikmtqspsflsasvgdrvtlnckasqnidkylnwyqqklgespklliyntnnlqtgips
    rfsgsgsgtdftltisslqpedvatyfclqhisrprtfgtgtklelkranaaptvsifpp
    steqlatggasvvclmnkfyprdisvkwkidgterngvlnsvtdqdsadstysmsstlsl
    tkadyqshnlytcqvvhktssspvvaknfnrnec
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bfoF (F:)
    evkllesggglvqpggsmrlscagsgftftdfymnwirqpagkapewlgfirdkakgytt
    eynpsvkgrftisrdntqnmlylqmntlraedtatyycareghtaapfdywgqgvmvtvs
    saqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqs
    glytltssvtsstwpsqtvtcnvahpasstkvdkkv
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bfoG (G:)
    dikmtqspsflsasvgdrvtlnckasqnidkylnwyqqklgespklliyntnnlqtgips
    rfsgsgsgtdftltisslqpedvatyfclqhisrprtfgtgtklelkranaaptvsifpp
    steqlatggasvvclmnkfyprdisvkwkidgterngvlnsvtdqdsadstysmsstlsl
    tkadyqshnlytcqvvhktssspvvaknfnrnec
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bfoH (H:)
    evkllesggglvqpggsmrlscagsgftftdfymnwirqpagkapewlgfirdkakgytt
    eynpsvkgrftisrdntqnmlylqmntlraedtatyycareghtaapfdywgqgvmvtvs
    saqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqs
    glytltssvtsstwpsqtvtcnvahpasstkvdkkv