PDB entry 1bfn

View 1bfn on RCSB PDB site
Description: beta-amylase/beta-cyclodextrin complex
Class: hydrolase
Keywords: hydrolase, beta-amylase, beta-cyclodextrin, recombinant
Deposited on 1998-05-22, released 1998-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.158
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-amylase
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10538 (Start-494)
      • cloning artifact (75)
      • variant (201)
      • variant (398)
    Domains in SCOPe 2.07: d1bfna_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bfnA (A:)
    atsdsnmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiie
    lkgpkqydwrayrsllqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhd
    ifytnrsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievg
    lgpagelrypsypqsqgwefpgigefqcydkylkadfkaavaraghpewelpddagkynd
    vpestgffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgih
    wwykvenhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpq
    elvqqvlsggwredirvagenalprydataynqiilnarpqgvnnngppklsmfgvtylr
    lsddllqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkpt
    lpfpwlpetdmkvdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bfnA (A:)
    nmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiielkgpk
    qydwrayrsllqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhdifytn
    rsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievglgpag
    elrypsypqsqgwefpgigefqcydkylkadfkaavaraghpewelpddagkyndvpest
    gffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgihwwykv
    enhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpqelvqq
    vlsggwredirvagenalprydataynqiilnarpqgvnnngppklsmfgvtylrlsddl
    lqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkptlpfpw
    lpetdmkvdg