PDB entry 1bfl

View 1bfl on RCSB PDB site
Description: fructose-1,6-bisphosphatase complexed with fructose-6-phosphate and zinc ions
Deposited on 1998-05-21, released 1999-05-25
The last revision was dated 1999-05-28, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.19
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructose-1,6-bisphosphatase
    Species: SUS SCROFA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: fructose-1,6-bisphosphatase
    Species: SUS SCROFA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: F6P, ZN, PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1bflA (A:)
    tdqaafdtnivtltrfvmeegrkargtgemtqllnslctavkaistavrkagiahlygia
    gstnvtgdqvkkldvlsndlvinvlkssfatcvlvseedknaiivepekrgkyvvcfdpl
    dgssnidclvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvng
    vncfmldpaigefilvdrdvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapy
    garyvgsmvadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgke
    avldivptdihqrapiilgspedvtelleiyqkhaak
    

    Sequence, based on observed residues (ATOM records):
    >1bflA (A:)
    tltrfvmeegrkargtgemtqllnslctavkaistavrkagiahlygiagstnvtgdqvk
    kldvlsndlvinvlkssfatcvlvseedknaiivepekrgkyvvcfdpldgssnidclvs
    igtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvngvncfmldpaig
    efilvdrdvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapygaryvgsmvad
    vhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgkeavldivptdih
    qrapiilgspedvtelleiyqkha
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1bflB (B:)
    tdqaafdtnivtltrfvmeegrkargtgemtqllnslctavkaistavrkagiahlygia
    gstnvtgdqvkkldvlsndlvinvlkssfatcvlvseedknaiivepekrgkyvvcfdpl
    dgssnidclvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvng
    vncfmldpaigefilvdrdvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapy
    garyvgsmvadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgke
    avldivptdihqrapiilgspedvtelleiyqkhaak
    

    Sequence, based on observed residues (ATOM records):
    >1bflB (B:)
    tltrfvmeegrkargtgemtqllnslctavkaistavrkagiahlygiagstnvtgdqvk
    kldvlsndlvinvlkssfatcvlvseedknaiivepekrgkyvvcfdpldgssnidclvs
    igtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvngvncfmldpaig
    efilvdrdvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapygaryvgsmvad
    vhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgkeavldivptdih
    qrapiilgspedvtelleiyqkha