PDB entry 1bfj
View 1bfj on RCSB PDB site
Description: solution structure of the c-terminal sh2 domain of the p85alpha regulatory subunit of phosphoinositide 3-kinase, nmr, minimized average structure
Class: sh2 domain
Keywords: sh2 domain, p85alpha, pi 3-kinase, nmr, c terminal sh2 domain
Deposited on
1997-11-18, released
1998-02-25
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: p85 alpha
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1bfja_
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1bfjA (A:)
medlphhdektwnvgssnrnkaenllrgkrdgtflvresskqgcyacsvvvdgevkhcvi
nktatgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvyaqqrr
Sequence, based on observed residues (ATOM records): (download)
>1bfjA (A:)
edlphhdektwnvgssnrnkaenllrgkrdgtflvresskqgcyacsvvvdgevkhcvin
ktatgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvyaqqrr