PDB entry 1bfj

View 1bfj on RCSB PDB site
Description: solution structure of the c-terminal sh2 domain of the p85alpha regulatory subunit of phosphoinositide 3-kinase, nmr, minimized average structure
Class: sh2 domain
Keywords: sh2 domain, p85alpha, pi 3-kinase, nmr, c terminal sh2 domain
Deposited on 1997-11-18, released 1998-02-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p85 alpha
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bfja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bfjA (A:)
    medlphhdektwnvgssnrnkaenllrgkrdgtflvresskqgcyacsvvvdgevkhcvi
    nktatgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvyaqqrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bfjA (A:)
    edlphhdektwnvgssnrnkaenllrgkrdgtflvresskqgcyacsvvvdgevkhcvin
    ktatgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvyaqqrr