PDB entry 1bfg

View 1bfg on RCSB PDB site
Description: crystal structure of basic fibroblast growth factor at 1.6 angstroms resolution
Class: growth factor
Keywords: growth factor
Deposited on 1993-04-15, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.153
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: basic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09038
      • conflict (68)
      • conflict (86)
    Domains in SCOPe 2.07: d1bfga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bfgA (A:)
    palpedggsgafppghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeer
    gvvsikgvsanrylamkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkr
    tgqyklgsktgpgqkailflpmsaks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bfgA (A:)
    dpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanrylamke
    dgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqkail
    flpmsa