PDB entry 1bfe

View 1bfe on RCSB PDB site
Description: the third pdz domain from the synaptic protein psd-95
Class: peptide recognition
Keywords: peptide recognition, protein localization
Deposited on 1998-05-20, released 1998-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: psd-95
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bfea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1bfeA (A:)
gspeflgeedipreprrivihrgstglgfniiggedgegifisfilaggpadlsgelrkg
dqilsvngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeansrvnssgrivtn

    Sequence, based on observed residues (ATOM records): (download) 
    >1bfeA (A:)
dipreprrivihrgstglgfniiggedgegifisfilaggpadlsgelrkgdqilsvngv
dlrnasheqaaialknagqtvtiiaqykpeeysrfeansrvnssgrivtn