PDB entry 1bfb

View 1bfb on RCSB PDB site
Description: basic fibroblast growth factor complexed with heparin tetramer fragment
Class: growth factor
Keywords: growth factor, mitogen, vascularization, heparin-binding,
Deposited on 1995-12-12, released 1996-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.206
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: basic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09038
      • engineered (69)
      • engineered (87)
    Domains in SCOPe 2.07: d1bfba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bfbA (A:)
    lpalpedggsgafppghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaee
    rgvvsikgvsanrylamkedgrllasksvtdecffferlesnnyntyrsrkytswyvalk
    rtgqyklgsktgpgqkailflpmsaks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bfbA (A:)
    pkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanrylamked
    grllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqkailf
    lpms