PDB entry 1bf9

View 1bf9 on RCSB PDB site
Description: n-terminal egf-like domain from human factor vii, nmr, 23 structures
Class: blood coagulation
Keywords: blood coagulation, egf, hydrolase, serine protease
Deposited on 1998-05-28, released 1999-02-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: factor vii
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bf9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bf9A (A:)
    sdgdqcasspcqnggsckdqlqsyicfclpafegrncethk