PDB entry 1bf8

View 1bf8 on RCSB PDB site
Description:
Deposited on 1998-05-28, released 1998-11-18
The last revision prior to the SCOP 1.61 freeze date was dated 1998-11-18, with a file datestamp of 1998-11-18.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1bf8_1, d1bf8_2

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bf8_ (-)
    gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme