PDB entry 1bf8

View 1bf8 on RCSB PDB site
Description: periplasmic chaperone fimc, nmr, 20 structures
Class: chaperone
Keywords: chaperone, fimc, periplasmic chaperone, pilus chaperone, type-I pili
Deposited on 1998-05-28, released 1998-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chaperone protein fimc
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bf8a1, d1bf8a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bf8A (A:)
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
agsnityrtindygaltpkmtgvme